Men's Rope Two-Tone Band Rings - NM22 - Roselle Jewelry

NM22 - Men's Vintage Rope Two-Tone Gold Wedding Band Ring

People are viewing this right now
sold in last hours
$852.29 AUD
In Stock Pre order Out of stock

Braided Color: White Gold + Yellow Gold

White Gold + Yellow Gold
White Gold + Rose Gold
Yellow Gold + Rose Gold
White Gold Only
Yellow Gold Only
Rose Gold Only

Metal: S925 Silver (Platinum Plated)

S925 Silver (Platinum Plated)
9K Gold
14K Gold
18K Gold

Embrace the timeless elegance of the NM22 Men's Rope Wedding Band from Roselle Jewelry. This ring refines the classic rope motif with a touch of vintage sophistication. Featuring a central twisted rope design flanked by contrasting gold rails, the NM22 often incorporates subtle detailing like milgrain (beaded) edges or step profiles that frame the twist like a work of art. The two-tone combination highlights the intricate texture, symbolizing the weaving together of two unique stories into a harmonious whole. It is a ring that speaks of enduring love, patience, and a bond that grows more beautiful with time. Handcrafted in 18K gold.

Product Code NM22
Width(mm) 6.0
Size HK#10 ~ HK#30

american expressapple paygoogle payvisamasterunionpaypaypalfpspaymealipaywechatpayalipay hkshopify paydiscoverdiners club